Skip to product information
1 of 1

CISD1, Human (His)

CISD1, Human (His)

Size

SKU:QM-0202566-01

£69.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The CISD1 protein acts as an L-cysteine aminotransferase, mediating the reversible transfer between L-cysteine and 2-oxoglutarate. Facilitated by the pyridoxal 5'-phosphate (PLP) cofactor, this process produces 2-oxo-3-sulfanylpropionate and L-glutamic acid. CISD1 Protein, Human (His) is the recombinant human-derived CISD1 protein, expressed by E. coli , with N-His, N-6*His labeled tag.

  • Molecular Formula

    55847 (Gene_ID) Q9NZ45/NP_060934.1 (K32-T108) (Accession)

  • Smiles

    KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202566-01
5 µgQM-0202566-01
£69.50/ea
£0.00
£69.50/ea £0.00
10 µgQM-0202566-02
10 µgQM-0202566-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0202566-03
50 µgQM-0202566-03
£297.86/ea
£0.00
£297.86/ea £0.00
100 µgQM-0202566-04
100 µgQM-0202566-04
£470.39/ea
£0.00
£470.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CISD1, Human (His)

CISD1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.