Skip to product information
1 of 1

Claudin-6/CLDN6-VLP, Human (HEK293, GFP)

Claudin-6/CLDN6-VLP, Human (HEK293, GFP)

Size

SKU:QM-0111544

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Claudin-6/CLDN6 Protein-VLP, Human (HEK293, GFP) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

  • Molecular Formula

    9074 (Gene_ID) P56747 (M1-V220) (Accession)

  • Smiles

    MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0111544
1 EachQM-0111544
£0.00/ea
£0.00
£0.00/ea £0.00

Claudin-6/CLDN6-VLP, Human (HEK293, GFP)

Claudin-6/CLDN6-VLP, Human (HEK293, GFP) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.