Claudin-6/CLDN6-VLP, Human (HEK293, GFP)
Claudin-6/CLDN6-VLP, Human (HEK293, GFP)
SKU:QM-0111544
Request quote or documents

Product Details
-
Description
Claudin-6/CLDN6 Protein-VLP, Human (HEK293, GFP) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
-
Molecular Formula
9074 (Gene_ID) P56747 (M1-V220) (Accession)
-
Smiles
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Claudin-6/CLDN6-VLP, Human (HEK293, GFP)
Claudin-6/CLDN6-VLP, Human (HEK293, GFP) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.