CLEC-1/CLEC1A, Rat (HEK293, Fc)

Name: CLEC-1/CLEC1A, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0204438-01
Price: 74.68 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204438-01

£74.68 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.
Molecular Formula
500337 (Gene_ID) D3ZGU3 (Q73-Q269) (Accession)
Smiles
QFYQLSNTQQDSITEKDERLGNMSRQLQSLQTQNRKLTETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWHGNKCYQFYKESKTWQSCEYFCLADNATMLKISTQEELDFAMPQSYSEFFYSYWTGLSRNGSGKAWLWTDGTPYSFELFEIIIDPTNLRSRDCMTIFNGKAYSKDCKELRRCACERVAGRVVPEELQ
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204438-01	5 µgQM-0204438-01 £74.68/ea	£0.00	Quantity	£74.68/ea	£0.00

10 µgQM-0204438-02	10 µgQM-0204438-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0204438-03	50 µgQM-0204438-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0204438-04	100 µgQM-0204438-04 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CLEC-1/CLEC1A, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.