Skip to product information
1 of 1

CLEC-1/CLEC1A, Rat (HEK293, Fc)

CLEC-1/CLEC1A, Rat (HEK293, Fc)

Size

SKU:QM-0204438-01

£74.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    500337 (Gene_ID) D3ZGU3 (Q73-Q269) (Accession)

  • Smiles

    QFYQLSNTQQDSITEKDERLGNMSRQLQSLQTQNRKLTETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWHGNKCYQFYKESKTWQSCEYFCLADNATMLKISTQEELDFAMPQSYSEFFYSYWTGLSRNGSGKAWLWTDGTPYSFELFEIIIDPTNLRSRDCMTIFNGKAYSKDCKELRRCACERVAGRVVPEELQ

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204438-01
5 µgQM-0204438-01
£74.68/ea
£0.00
£74.68/ea £0.00
10 µgQM-0204438-02
10 µgQM-0204438-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0204438-03
50 µgQM-0204438-03
£316.08/ea
£0.00
£316.08/ea £0.00
100 µgQM-0204438-04
100 µgQM-0204438-04
£476.46/ea
£0.00
£476.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CLEC-1/CLEC1A, Rat (HEK293, Fc)

CLEC-1/CLEC1A, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.