Name: CLEC5A/MDL-1, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0169033-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
679787 (Gene_ID) D3ZPN6 (V30-K190) (Accession)
Smiles
VFGKSSDGFIPTESYGTTNVQNVSQIFGRSDESFVPTRSSGTACPNNWDFHQGRCFFFSTSESPWKNSRDYCATKGSTLAIVDTPKKLKFLQDRAGAENYFIGLIRQPGEKKWRWVNNSVFKGNVTNQEQNFNCVTIGLTMTFDAASCDISYRWICETTPK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169033-01	5 µgQM-0169033-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0169033-02	10 µgQM-0169033-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

50 µgQM-0169033-03	50 µgQM-0169033-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

100 µgQM-0169033-04	100 µgQM-0169033-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

500 µgQM-0169033-05	500 µgQM-0169033-05 £1,134.99/ea	£0.00	Quantity	£1,134.99/ea	£0.00

1 mgQM-0169033-06	1 mgQM-0169033-06 £1,893.15/ea	£0.00	Quantity	£1,893.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CLEC5A/MDL-1, Rat (HEK293, His)

CLEC5A/MDL-1, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.