CLIC5, Human (His)

The CLIC5 protein is essential for normal hearing and contributes to the formation of stereocilia and the development of the organ of Corti in the inner ear. It forms poorly selective ion channels that may transport chloride ions. CLIC5 Protein, Human (His) is the recombinant human-derived CLIC5 protein, expressed by E. coli , with N-6*His labeled tag.

53405 (Gene_ID) Q9NZA1-2 (M1-S251) (Accession)

MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

98

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.