Skip to product information
1 of 1

CLPS, Human (sf9, His)

CLPS, Human (sf9, His)

Size

SKU:QM-0200629-01

£136.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CLPS or colipase is an important cofactor for pancreatic lipase that helps anchor it at the lipid-water interface. In the absence of colipase, pancreatic lipase is easily washed away by bile salts, which inhibit the enzyme. CLPS Protein, Human (sf9, His) is the recombinant human-derived CLPS protein, expressed by Sf9 insect cells , with C-His labeled tag.

  • Molecular Formula

    1208 (Gene_ID) P04118 (A18-Q112) (Accession)

  • Smiles

    APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

  • Purity

    90

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0200629-01
10 µgQM-0200629-01
£136.63/ea
£0.00
£136.63/ea £0.00
50 µgQM-0200629-02
50 µgQM-0200629-02
£341.08/ea
£0.00
£341.08/ea £0.00
100 µgQM-0200629-03
100 µgQM-0200629-03
£495.39/ea
£0.00
£495.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CLPS, Human (sf9, His)

CLPS, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.