Skip to product information
1 of 1

Clusterin/APOJ, Human (HEK293, Fc-His)

Clusterin/APOJ, Human (HEK293, Fc-His)

Size

SKU:QM-0205386-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Clusterin/APOJ Protein, Human (HEK293, Fc-His) expresses in HEK293 with an Fc fragment and a His tag at the N-terminus. Apolipoprotein J (ApoJ) is involved in numerous physiological process important for lipid transportation, vascular smooth muscle cell differentiation, and has the potential for atherosclerosis[1].

  • Molecular Formula

    1191 (Gene_ID) P10909-1 (D23-E449) (Accession)

  • Smiles

    DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

  • Purity

    97.43

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205386-01
5 µgQM-0205386-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0205386-02
10 µgQM-0205386-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0205386-03
50 µgQM-0205386-03
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0205386-04
100 µgQM-0205386-04
£492.26/ea
£0.00
£492.26/ea £0.00
250 µgQM-0205386-05
250 µgQM-0205386-05
£890.78/ea
£0.00
£890.78/ea £0.00
500 µgQM-0205386-06
500 µgQM-0205386-06
£1,377.99/ea
£0.00
£1,377.99/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Clusterin/APOJ, Human (HEK293, Fc-His)

Clusterin/APOJ, Human (HEK293, Fc-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.