Clusterin/APOJ, Human (HEK293, His)

Name: Clusterin/APOJ, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0205180-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205180-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the C-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD) [1].
Molecular Formula
1191 (Gene_ID) P10909-1 (D23-E449) (Accession)
Smiles
DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205180-01	5 µgQM-0205180-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205180-02	10 µgQM-0205180-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205180-03	50 µgQM-0205180-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0205180-04	100 µgQM-0205180-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

500 µgQM-0205180-05	500 µgQM-0205180-05 £1,156.87/ea	£0.00	Quantity	£1,156.87/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Clusterin/APOJ, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.