1 1

Clusterin-like 1/CLUL1, Human (HEK293, His)

Clusterin-like 1/CLUL1, Human (HEK293, His)

Size

QM-0195134-01

£122.88 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Clusterin-like protein 1/CLUL1 Protein belongs to the clusterin family.Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is the recombinant human-derived Clusterin-like protein 1/CLUL1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    27098 (Gene_ID) Q15846 (A21-A442) (Accession)

  • Smiles

    APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESA

  • Purity

    93

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0195134-01
5 µgQM-0195134-01
£122.88/ea		 £0.00
£122.88/ea £0.00
10 µgQM-0195134-02
10 µgQM-0195134-02
£227.39/ea		 £0.00
£227.39/ea £0.00
50 µgQM-0195134-03
50 µgQM-0195134-03
£548.15/ea		 £0.00
£548.15/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Clusterin-like 1/CLUL1, Human (HEK293, His)

Clusterin-like 1/CLUL1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.