Skip to product information
1 of 1

CNPY3/PRAT4A, Human (HEK293, Fc)

CNPY3/PRAT4A, Human (HEK293, Fc)

Size

SKU:QM-0202589-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CNPY3/PRAT4A is a Toll-like receptor (TLR) -specific co-chaperone of HSP90B1 and is essential for correct TLR folding (except TLR3) . It ensures controlled TLR exit from the endoplasmic reticulum, affecting innate and adaptive immune responses. CNPY3/PRAT4A Protein, Human (HEK293, Fc) is the recombinant human-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    10695 (Gene_ID) Q9BT09-1 (G31-P274) (Accession)

  • Smiles

    GPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSP

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202589-01
5 µgQM-0202589-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0202589-02
10 µgQM-0202589-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0202589-03
50 µgQM-0202589-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0202589-04
100 µgQM-0202589-04
£370.76/ea
£0.00
£370.76/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CNPY3/PRAT4A, Human (HEK293, Fc)

CNPY3/PRAT4A, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.