CNTF, Human (HEK293)

Name: CNTF, Human (HEK293)
Brand: QuantiMol
SKU: QM-0204253-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204253-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human (HEK293) is produced by HEK293 cells (M1-M200) with tag free.
Molecular Formula
1270 (Gene_ID) P26441 (M1-M200) (Accession)
Smiles
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Purity
99
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204253-01	2 µgQM-0204253-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204253-02	10 µgQM-0204253-02 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

50 µgQM-0204253-03	50 µgQM-0204253-03 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

100 µgQM-0204253-04	100 µgQM-0204253-04 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CNTF, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.