Skip to product information
1 of 1

CNTF, Human (His)

CNTF, Human (His)

Size

SKU:QM-0203570-01

£99.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human (His) is produced by E. coli (A2-M200) with N-terminal His-tag.

  • Molecular Formula

    1270 (Gene_ID) P26441 (A2-M200) (Accession)

  • Smiles

    AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

  • Purity

    97.5

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203570-01
5 µgQM-0203570-01
£99.68/ea
£0.00
£99.68/ea £0.00
10 µgQM-0203570-02
10 µgQM-0203570-02
£136.63/ea
£0.00
£136.63/ea £0.00
50 µgQM-0203570-03
50 µgQM-0203570-03
£318.00/ea
£0.00
£318.00/ea £0.00
100 µgQM-0203570-04
100 µgQM-0203570-04
£451.65/ea
£0.00
£451.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CNTF, Human (His)

CNTF, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.