Skip to product information
1 of 1

Coagulation Factor XII/F12, Pig (His)

Coagulation Factor XII/F12, Pig (His)

Size

SKU:QM-0205189-01

£266.27 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (His) is the recombinant pig-derived Coagulation Factor XII/F12 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    397474 (Gene_ID) O97507 (I20-R371) (Accession)

  • Smiles

    IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205189-01
5 µgQM-0205189-01
£266.27/ea
£0.00
£266.27/ea £0.00
10 µgQM-0205189-02
10 µgQM-0205189-02
£415.71/ea
£0.00
£415.71/ea £0.00
20 µgQM-0205189-03
20 µgQM-0205189-03
£675.73/ea
£0.00
£675.73/ea £0.00
50 µgQM-0205189-04
50 µgQM-0205189-04
£974.62/ea
£0.00
£974.62/ea £0.00
100 µgQM-0205189-05
100 µgQM-0205189-05
£1,433.88/ea
£0.00
£1,433.88/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Coagulation Factor XII/F12, Pig (His)

Coagulation Factor XII/F12, Pig (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.