Skip to product information
1 of 1

Coagulation factor XIII B/F13B, Human (HEK293, His)

Coagulation factor XIII B/F13B, Human (HEK293, His)

Size

SKU:QM-0198430-01

£91.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Coagulation factor XIII B/F13B Proteinas, the B chain of factor XIII, lacks catalytic activity but stabilizes A subunits and regulates thrombin-initiated transglutaminase formation. Functioning as a tetramer with two A chains (F13A1) and two B chains (F13B), it structurally supports the factor XIII complex, emphasizing its regulatory role in blood coagulation, particularly in transglutaminase activation by thrombin. Coagulation factor XIII B/F13B Protein, Human (HEK293, His) is the recombinant human-derived Coagulation factor XIII B/F13B protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    2165 (Gene_ID) P05160 (E21-T661) (Accession)

  • Smiles

    EEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCLAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCASGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYECATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSSVEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLRT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198430-01
5 µgQM-0198430-01
£91.38/ea
£0.00
£91.38/ea £0.00
10 µgQM-0198430-02
10 µgQM-0198430-02
£133.00/ea
£0.00
£133.00/ea £0.00
50 µgQM-0198430-03
50 µgQM-0198430-03
£370.76/ea
£0.00
£370.76/ea £0.00
100 µgQM-0198430-04
100 µgQM-0198430-04
£565.16/ea
£0.00
£565.16/ea £0.00
500 µgQM-0198430-05
500 µgQM-0198430-05
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Coagulation factor XIII B/F13B, Human (HEK293, His)

Coagulation factor XIII B/F13B, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.