Skip to product information
1 of 1

COL4A3, Human (His)

COL4A3, Human (His)

Size

SKU:QM-0195481-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM) . Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3 (IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    1285 (Gene_ID) Q01955 (G1427-K1668) (Accession)

  • Smiles

    GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195481-01
5 µgQM-0195481-01
£147.63/ea
£0.00
£147.63/ea £0.00
10 µgQM-0195481-02
10 µgQM-0195481-02
£277.21/ea
£0.00
£277.21/ea £0.00
50 µgQM-0195481-03
50 µgQM-0195481-03
£559.09/ea
£0.00
£559.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

COL4A3, Human (His)

COL4A3, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.