COL6A3, Human (HEK293, His)

Name: COL6A3, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0204398-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg

SKU:QM-0204398-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
COL6A3 protein is an important component of type VI collagen and has the function of a cell-binding protein. Collagen VI trimers are composed of three distinct chains: alpha-1 (VI), alpha-2 (VI), and alpha-3 (VI), alpha-5 (VI), or alpha-6 (VI) . COL6A3 Protein, Human (HEK293, His) is the recombinant human-derived COL6A3 protein, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
1293 (Gene_ID) P12111-1 (T3101-T3177) (Accession)
Smiles
TEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204398-01	2 µgQM-0204398-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

5 µgQM-0204398-02	5 µgQM-0204398-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0204398-03	10 µgQM-0204398-03 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0204398-04	50 µgQM-0204398-04 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

COL6A3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.