Skip to product information
1 of 1

Collectin-11/CL-K1, Mouse (HEK293, His)

Collectin-11/CL-K1, Mouse (HEK293, His)

Size

SKU:QM-0183993-01

£143.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Collectin-11/CL-K1 Protein is a secreted protein that activates tyrosine kinase receptors (EGFR, HER3) and ERK, JNK, and AKT signaling pathways to promote cell proliferation. Collectin-11/CL-K1 Protein plays an important role in innate immunity and apoptosis. Collectin-11/CL-K1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    71693 (Gene_ID) Q3SXB8-1 (Q27-L272) (Accession)

  • Smiles

    QQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDKENL

  • Purity

    93.03

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0183993-01
10 µgQM-0183993-01
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0183993-02
50 µgQM-0183993-02
£431.51/ea
£0.00
£431.51/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Collectin-11/CL-K1, Mouse (HEK293, His)

Collectin-11/CL-K1, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.