Skip to product information
1 of 1

Collectrin/TMEM27, Mouse (Myc, His-SUMO)

Collectrin/TMEM27, Mouse (Myc, His-SUMO)

Size

SKU:QM-0134897

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

  • Molecular Formula

    57394 (Gene_ID) Q9ESG4 (E15-P141) (Accession)

  • Smiles

    ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0134897
1 EachQM-0134897
£0.00/ea
£0.00
£0.00/ea £0.00

Collectrin/TMEM27, Mouse (Myc, His-SUMO)

Collectrin/TMEM27, Mouse (Myc, His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.