Collectrin/TMEM27, Mouse (Myc, His-SUMO)
Collectrin/TMEM27, Mouse (Myc, His-SUMO)
SKU:QM-0134897
Request quote or documents

Product Details
-
Description
The Collectrin protein plays a crucial role in amino acid transport by binding to SLC6A18 and SLC6A19 and regulating their surface transport and activity. Furthermore, it may affect the trafficking of SLC3A1 and SLC7A9 to the renal cortical cell membrane. Collectrin/TMEM27 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Collectrin protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
-
Molecular Formula
57394 (Gene_ID) Q9ESG4 (E15-P141) (Accession)
-
Smiles
ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
Collectrin/TMEM27, Mouse (Myc, His-SUMO)
Collectrin/TMEM27, Mouse (Myc, His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.