COMMD9, Human (His)

Name: COMMD9, Human (His)
Brand: QuantiMol
SKU: QM-0203003-01
Price: 81.92 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203003-01

£81.92 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
29099 (Gene_ID) Q9P000-1 (M1-K198) (Accession)
Smiles
MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK
Purity
93.4
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203003-01	5 µgQM-0203003-01 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0203003-02	10 µgQM-0203003-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0203003-03	50 µgQM-0203003-03 £342.81/ea	£0.00	Quantity	£342.81/ea	£0.00

100 µgQM-0203003-04	100 µgQM-0203003-04 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

COMMD9, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.