Skip to product information
1 of 1

Complement C3a, Mouse

Complement C3a, Mouse

Size

SKU:QM-0205996-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Complement C3/C3a protein activates the complement system, playing a central role in both classical and alternative pathways. C3b binds covalently to cell surface carbohydrates or immune aggregates, while C3a acts as an inflammatory mediator, inducing neutrophil chemoattraction and promoting smooth muscle contraction, increased vascular permeability, and histamine release. The shorter isoform of C3a stimulates B-cells. Complement C3a Protein, Mouse is the recombinant mouse-derived Complement C3/C3a protein, expressed by E. coli , with tag free.

  • Molecular Formula

    12266 (Gene_ID) P01027-1 (S671-R748) (Accession)

  • Smiles

    SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205996-01
2 µgQM-0205996-01
£61.22/ea
£0.00
£61.22/ea £0.00
5 µgQM-0205996-02
5 µgQM-0205996-02
£94.75/ea
£0.00
£94.75/ea £0.00
10 µgQM-0205996-03
10 µgQM-0205996-03
£143.13/ea
£0.00
£143.13/ea £0.00
50 µgQM-0205996-04
50 µgQM-0205996-04
£431.51/ea
£0.00
£431.51/ea £0.00
100 µgQM-0205996-05
100 µgQM-0205996-05
£658.72/ea
£0.00
£658.72/ea £0.00
250 µgQM-0205996-06
250 µgQM-0205996-06
£1,046.30/ea
£0.00
£1,046.30/ea £0.00
1 mgQM-0205996-07
1 mgQM-0205996-07
£1,932.04/ea
£0.00
£1,932.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Complement C3a, Mouse

Complement C3a, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.