Complement C5a, Cynomolgus

Name: Complement C5a, Cynomolgus
Brand: QuantiMol
SKU: QM-0204015-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204015-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Cynomolgus is the recombinant cynomolgus-derived Complement C5/C5a protein, expressed by E. coli , with tag free.
Molecular Formula
102125658 (Gene_ID) XP_015292262.1 (M678-R751) (Accession)
Smiles
MLQEKIEEIAAKYKHLVVKKCCYDGVRINHDETCEQRAARISVGPRCVKAFTECCVVASQLRANNSHKDLQLGR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204015-01	5 µgQM-0204015-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204015-02	10 µgQM-0204015-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0204015-03	50 µgQM-0204015-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0204015-04	100 µgQM-0204015-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Complement C5a, Cynomolgus is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.