1 1

Complement Factor D/Adipsin, Mouse (HEK293, His)

Complement Factor D/Adipsin, Mouse (HEK293, His)

Size

QM-0172263-01

£216.46 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Complement Factor D/Adipsin Protein cleaves factor B in complex with factor C3b, activating the C3bbb complex to form the C3 convertase in the alternate pathway, analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement Factor D/Adipsin protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    11537 (Gene_ID) P03953-1 (I26-S259) (Accession)

  • Smiles

    ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0172263-01
10 µgQM-0172263-01
£216.46/ea		 £0.00
£216.46/ea £0.00
50 µgQM-0172263-02
50 µgQM-0172263-02
£492.26/ea		 £0.00
£492.26/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Complement Factor D/Adipsin, Mouse (HEK293, His)

Complement Factor D/Adipsin, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.