1 1

Complement factor H/CFH, Human (HEK293, His)

Complement factor H/CFH, Human (HEK293, His)

Size

QM-0027817-01

£97.00 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Complement factor H/CFH Protein, Human (HEK293, His) is a recombinant complement factor H (CFH) protein with His tag. Human complement factor H, a central complement control protein, is a member of the regulators of complement activation family[1].

  • Molecular Formula

    3075 (Gene_ID) P08603-2 (E19-L449) (Accession)

  • Smiles

    EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTL

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0027817-01
5 µgQM-0027817-01
£97.00/ea		 £0.00
£97.00/ea £0.00
10 µgQM-0027817-02
10 µgQM-0027817-02
£143.13/ea		 £0.00
£143.13/ea £0.00
50 µgQM-0027817-03
50 µgQM-0027817-03
£404.78/ea		 £0.00
£404.78/ea £0.00
100 µgQM-0027817-04
100 µgQM-0027817-04
£614.98/ea		 £0.00
£614.98/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Complement factor H/CFH, Human (HEK293, His)

Complement factor H/CFH, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.