1 1

Coronin-6/CORO6, Human (His)

Coronin-6/CORO6, Human (His)

Size

QM-0122241

Price on request

Request quote or documents

View full details

Product Details

  • Description

    Coronin-6/CORO6 Protein, Human (His) is the recombinant human-derived Coronin-6/CORO6 protein, expressed by E. coli, with N-6*His labeled tag.

  • Molecular Formula

    84940 (Gene_ID) Q6QEF8-4 (E255-D472) (Accession)

  • Smiles

    MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0122241
1 EachQM-0122241
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

Coronin-6/CORO6, Human (His)

Coronin-6/CORO6, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.