CPLX3, Human (HEK293, His)

Name: CPLX3, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0203559-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203559-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CPLX3 protein is a complex protein that regulates synaptic vesicle fusion through the SNARE protein complex. CPLX3 Protein, Human (HEK293, His) is the recombinant human-derived CPLX3 protein, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
594855 (Gene_ID) Q8WVH0 (M1-K154) (Accession)
Smiles
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEK
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203559-01	5 µgQM-0203559-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0203559-02	10 µgQM-0203559-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0203559-03	50 µgQM-0203559-03 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

100 µgQM-0203559-04	100 µgQM-0203559-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CPLX3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.