CRABP1, Human

Name: CRABP1, Human
Brand: QuantiMol
SKU: QM-0204505-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204505-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CRABP1 protein is present in the cytoplasm and is involved in regulating the entry of retinoic acid into nuclear retinoic acid receptors. As an important molecular player, CRABP1 may mediate the complex process of interaction between retinoic acid and its nuclear receptor. CRABP1 Protein, Human is the recombinant human-derived CRABP1 protein, expressed by E. coli , with tag free.
Molecular Formula
1381 (Gene_ID) AAH22069.1 (M1-E137) (Accession)
Smiles
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204505-01	5 µgQM-0204505-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204505-02	10 µgQM-0204505-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0204505-03	50 µgQM-0204505-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0204505-04	100 µgQM-0204505-04 £359.82/ea	£0.00	Quantity	£359.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CRABP1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.