Skip to product information
1 of 1

CRABP2, Human (His)

CRABP2, Human (His)

Size

SKU:QM-0202374-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CRABP2 (cellular retinoic acid binding protein 2) plays a crucial role in cellular processes by transporting retinoic acid into the nucleus and mediating its contact with nuclear retinoic acid receptors. CRABP2 interacts with RXR (retinoic acid X receptor) and RARA (retinoic acid receptor Alpha) to regulate the retinoic acid signaling pathway. CRABP2 Protein, Human (His) is the recombinant human-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    1382 (Gene_ID) P29373 (P2-E138) (Accession)

  • Smiles

    PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202374-01
5 µgQM-0202374-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0202374-02
10 µgQM-0202374-02
£62.26/ea
£0.00
£62.26/ea £0.00
50 µgQM-0202374-03
50 µgQM-0202374-03
£133.00/ea
£0.00
£133.00/ea £0.00
100 µgQM-0202374-04
100 µgQM-0202374-04
£249.26/ea
£0.00
£249.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CRABP2, Human (His)

CRABP2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.