Skip to product information
1 of 1

CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi)

CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi)

Size

SKU:QM-0118616

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    57823 (Gene_ID) Q9NQ25-1 (S23-M226) (Accession)

  • Smiles

    SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0118616
1 EachQM-0118616
£0.00/ea
£0.00
£0.00/ea £0.00

CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi)

CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.