CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi)
CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi)
SKU:QM-0118616
Request quote or documents

Product Details
-
Description
The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
-
Molecular Formula
57823 (Gene_ID) Q9NQ25-1 (S23-M226) (Accession)
-
Smiles
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi)
CRACC/SLAMF7, Human (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.