CRACC/SLAMF7, Human (HEK293, His)

Name: CRACC/SLAMF7, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0201428-01
Price: 111.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0201428-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (HEK293, His) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
57823 (Gene_ID) Q9NQ25-1 (S23-M226) (Accession)
Smiles
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0201428-01	10 µgQM-0201428-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0201428-02	50 µgQM-0201428-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0201428-03	100 µgQM-0201428-03 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CRACC/SLAMF7, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.