Skip to product information
1 of 1

CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His)

CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His)

Size

SKU:QM-0124867

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    102133710 (Gene_ID) F7HQ72/XP_005541294.1 (S23-M226) (Accession)

  • Smiles

    SGSVKELVGSIGGAVTFPLKSEVKQVDSIVWTFNTTTLVTIQPEGGPMIVTQNRNKERVHFPDGGYSLKLSKLKKNDSGIYNVEIYSSSLQDPFTRKYVLRVYEHLSKPKVTMGLQSNKNGTCVTNLTCHMEHGEEDVIYTWKALGQAVNESHNGSILPISWRWGESDMTFICTVRNPVSSNSSSPILARKLCEGAADDSDSSM

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0124867
1 EachQM-0124867
£0.00/ea
£0.00
£0.00/ea £0.00

CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His)

CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.