CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His)
CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His)
SKU:QM-0124867
Request quote or documents

Product Details
-
Description
The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
102133710 (Gene_ID) F7HQ72/XP_005541294.1 (S23-M226) (Accession)
-
Smiles
SGSVKELVGSIGGAVTFPLKSEVKQVDSIVWTFNTTTLVTIQPEGGPMIVTQNRNKERVHFPDGGYSLKLSKLKKNDSGIYNVEIYSSSLQDPFTRKYVLRVYEHLSKPKVTMGLQSNKNGTCVTNLTCHMEHGEEDVIYTWKALGQAVNESHNGSILPISWRWGESDMTFICTVRNPVSSNSSSPILARKLCEGAADDSDSSM
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His)
CRACC/SLAMF7, Rhesus Macaque/Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.