Skip to product information
1 of 1

Creatine kinase M-type/CKM, Human (His)

Creatine kinase M-type/CKM, Human (His)

Size

SKU:QM-0196131-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Creatine kinase M-type/CKM Protein, Human (His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by E. coli, with N-His labeled tag.

  • Molecular Formula

    1158 (Gene_ID) AAH07462.1 (M1-K381) (Accession)

  • Smiles

    MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0196131-01
5 µgQM-0196131-01
£61.22/ea
£0.00
£61.22/ea £0.00
10 µgQM-0196131-02
10 µgQM-0196131-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0196131-03
50 µgQM-0196131-03
£227.39/ea
£0.00
£227.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Creatine kinase M-type/CKM, Human (His)

Creatine kinase M-type/CKM, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.