Creatine kinase M-type/CKM, Mouse (His)
Creatine kinase M-type/CKM, Mouse (His)
SKU:QM-0193169-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
CKM is a creatine kinase M-type protein that centrally catalyzes reversible phosphate transfer between ATP and various phosphogens, especially creatine phosphate. As a creatine kinase isoenzyme, CKM plays a crucial role in energy transduction, particularly in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm. Creatine kinase M-type/CKM Protein, Mouse (His) is the recombinant mouse-derived Creatine kinase M-type/CKM protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
12715 (Gene_ID) P07310 (M1-K381) (Accession)
-
Smiles
MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
-
Purity
94
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0086965-01 Sterile 10 mM Histidine, pH 5.5 buffer
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0009933-01 L-Histidine buffer, Sterile
- QM-0183109-01 ε-Poly-L-lysine (hydrochloride) (MV 2000-5000)
- QM-0131878-01 ε-Poly-L-lysine (MW 3800-4200) [CAS 28211-04-3]
- QM-0067179 γ-L-Glutamyl-S-allyl-L-cysteine [CAS 1299925-32-8]
- QM-0048489-01 β-N-methylamino-L-alanine (hydrochloride) (Standard) [CAS 16012-55-8]
- QM-0025942-01 Valylleucine (TFA) [CAS 27530-02-5]
- QM-0024513 γ-Glutamylornithine (Standard) [CAS 56523-61-6]
- QM-0024512 β-Lysine [CAS 4299-56-3]
Other industry favorites
- QM-0086965-01 Sterile 10 mM Histidine, pH 5.5 buffer
- QM-0162455-01 L-Methionine-13C, d3 [CAS 73488-65-0]
- QM-0205375-01 γ-Glutamyl-S-allylcysteine [CAS 91216-95-4]
- QM-0204930-01 α-Methyl-DL-aspartic acid [CAS 2792-66-7]
- QM-0161381-01 β-1,3-N-Acetylglucosaminyltransferase 4
- QM-0162316-01 β-Alanine-15N [CAS 204451-53-6]
- QM-0013113 β-Hydroxybutyrate methionine
- QM-0005220-01 β-cyano-L-Alanine (Standard) [CAS 6232-19-5]
- QM-0161380-01 α-1,4-N-Acetylglucosaminyltransferase 4
- QM-0143593-01 Ziprasidone amino acid [CAS 1159977-64-6]
Creatine kinase M-type/CKM, Mouse (His)
Creatine kinase M-type/CKM, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.