CRIPT, Human (His)

Name: CRIPT, Human (His)
Brand: QuantiMol
SKU: QM-0204032-01
Price: 127.38 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204032-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
9419 (Gene_ID) Q9P021 (M1-V101) (Accession)
Smiles
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Purity
97.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204032-01	5 µgQM-0204032-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

10 µgQM-0204032-02	10 µgQM-0204032-02 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

50 µgQM-0204032-03	50 µgQM-0204032-03 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

100 µgQM-0204032-04	100 µgQM-0204032-04 £951.53/ea	£0.00	Quantity	£951.53/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CRIPT, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.