Crlf1, Mouse (HEK293, His, solution)

Name: Crlf1, Mouse (HEK293, His, solution)
Brand: QuantiMol
SKU: QM-0184474-01
Price: 263.32 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0184474-01

£263.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Crlf1 protein combines with CLCF1 to form an important neurotrophic cytokine involved in neuronal development. It plays a crucial role in the initiation and maintenance of lactation in neonatal mice and is associated with immune system regulation. Crlf1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Crlf1 protein, expressed by HEK293 , with His labeled tag.
Molecular Formula
12931 (Gene_ID) Q9JM58 (G40-G425) (Accession)
Smiles
GAHTAVISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAARGPAG
Purity
90
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0184474-01	10 µgQM-0184474-01 £263.32/ea	£0.00	Quantity	£263.32/ea	£0.00

50 µgQM-0184474-02	50 µgQM-0184474-02 £595.02/ea	£0.00	Quantity	£595.02/ea	£0.00

100 µgQM-0184474-03	100 µgQM-0184474-03 £904.85/ea	£0.00	Quantity	£904.85/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Crlf1, Mouse (HEK293, His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.