Cryptic, Human (HEK293, His)

Name: Cryptic, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0180039-01
Price: 131.88 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180039-01

£131.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Cryptic Protein, Human (HEK 293, His), a member of the epidermal growth factor-Cripto/FRL-1/Cryptic (EGF-CFC) gene family, is involved in the evolutionarily conserved establishment of left-right lateral asymmetry.
Molecular Formula
55997 (Gene_ID) P0CG37 (Y26-G169) (Accession)
Smiles
YQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180039-01	10 µgQM-0180039-01 £131.88/ea	£0.00	Quantity	£131.88/ea	£0.00

50 µgQM-0180039-02	50 µgQM-0180039-02 £397.49/ea	£0.00	Quantity	£397.49/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Cryptic, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.