CSF1R, Rat (HEK293, Fc)
CSF1R, Rat (HEK293, Fc)
SKU:QM-0096389
Request quote or documents

Product Details
-
Description
CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)
-
Smiles
MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
CSF1R, Rat (HEK293, Fc)
CSF1R, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.