Skip to product information
1 of 1

CSRP1, Mouse (His)

CSRP1, Mouse (His)

Size

SKU:QM-0197127-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CSRP1 protein may contribute to neuronal development through its interactions with ASCC1, ASCC2, and TRIP4. These connections suggest a regulatory role for CSRP1 in molecular events involved in neuronal growth and differentiation. Understanding the dynamics of CSRP1 interactions with these proteins could enhance our knowledge of neuronal development and facilitate targeted interventions in neurological contexts. CSRP1 Protein, Mouse (His) is the recombinant mouse-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    13007 (Gene_ID) P97315 (M1-E193) (Accession)

  • Smiles

    MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

  • Purity

    95.2

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0197127-01
5 µgQM-0197127-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0197127-02
10 µgQM-0197127-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0197127-03
50 µgQM-0197127-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CSRP1, Mouse (His)

CSRP1, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.