Skip to product information
1 of 1

CTACK/CCL27, Mouse

CTACK/CCL27, Mouse

Size

SKU:QM-0202499-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    20301 (Gene_ID) Q9Z1X0-1 (L26-N120) (Accession)

  • Smiles

    LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202499-01
2 µgQM-0202499-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0202499-02
10 µgQM-0202499-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0202499-03
50 µgQM-0202499-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0202499-04
100 µgQM-0202499-04
£669.65/ea
£0.00
£669.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CTACK/CCL27, Mouse

CTACK/CCL27, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.