CTHRC1, Human (HEK293, His)

Name: CTHRC1, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0169130-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0169130-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CTHRC1 Protein, Human (HEK293, His) is a negative regulator of collagen matrix deposition. CTHRC1, a secreted 28-kDa protein, is a glycosylated protein with a signal sequence.
Molecular Formula
115908 (Gene_ID) Q96CG8-1 (S31-K243) (Accession)
Smiles
SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Purity
95.52
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169130-01	5 µgQM-0169130-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0169130-02	10 µgQM-0169130-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0169130-03	50 µgQM-0169130-03 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

100 µgQM-0169130-04	100 µgQM-0169130-04 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

500 µgQM-0169130-05	500 µgQM-0169130-05 £1,212.76/ea	£0.00	Quantity	£1,212.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CTHRC1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.