CTLA-4, Human (HEK293)

Name: CTLA-4, Human (HEK293)
Brand: QuantiMol
SKU: QM-0195566-01
Price: 136.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0195566-01

£136.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free.
Molecular Formula
1493 (Gene_ID) P16410 (K36-D161) (Accession)
Smiles
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
Purity
95
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0195566-01	10 µgQM-0195566-01 £136.63/ea	£0.00	Quantity	£136.63/ea	£0.00

50 µgQM-0195566-02	50 µgQM-0195566-02 £318.00/ea	£0.00	Quantity	£318.00/ea	£0.00

100 µgQM-0195566-03	100 µgQM-0195566-03 £462.58/ea	£0.00	Quantity	£462.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CTLA-4, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.