Skip to product information
1 of 1

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4, Rhesus Macaque (HEK293, His)

Size

SKU:QM-0204939-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

  • Smiles

    AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204939-01
5 µgQM-0204939-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0204939-02
10 µgQM-0204939-02
£64.33/ea
£0.00
£64.33/ea £0.00
50 µgQM-0204939-03
50 µgQM-0204939-03
£111.63/ea
£0.00
£111.63/ea £0.00
100 µgQM-0204939-04
100 µgQM-0204939-04
£147.63/ea
£0.00
£147.63/ea £0.00
500 µgQM-0204939-05
500 µgQM-0204939-05
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.