CXADR, Mouse (HEK293, Fc)

Name: CXADR, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205317-01
Price: 111.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg 500 µg 1 mg

SKU:QM-0205317-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CXADR protein is a key component of the epithelial apical junction complex, which maintains the integrity of tight junctions and enables leukocyte migration through adhesive interactions with JAML. This interaction activates γ-δ T cells and promotes tissue repair through cell signaling involving PI3 kinase and MAP kinase. CXADR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CXADR protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
13052 (Gene_ID) P97792 (L20-G237) (Accession)
Smiles
LSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAG
Purity
96.49
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0205317-01	10 µgQM-0205317-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0205317-02	50 µgQM-0205317-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0205317-03	100 µgQM-0205317-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0205317-04	500 µgQM-0205317-04 £1,312.38/ea	£0.00	Quantity	£1,312.38/ea	£0.00

1 mgQM-0205317-05	1 mgQM-0205317-05 £1,932.04/ea	£0.00	Quantity	£1,932.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CXADR, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.