Skip to product information
1 of 1

CXCL14/BRAK, Human

CXCL14/BRAK, Human

Size

SKU:QM-0200074-01

£94.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CXCL14 (also known as breast and kidney-expressed chemokine (BRAK) ), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity[1][2]. CXCL14/BRAK Protein, Human is produced in E. coli, and consists of 77 amino acids (S35-E111) .

  • Molecular Formula

    9547 (Gene_ID) O95715 (S35-E111) (Accession)

  • Smiles

    SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0200074-01
2 µgQM-0200074-01
£94.75/ea
£0.00
£94.75/ea £0.00
10 µgQM-0200074-02
10 µgQM-0200074-02
£258.98/ea
£0.00
£258.98/ea £0.00
50 µgQM-0200074-03
50 µgQM-0200074-03
£614.98/ea
£0.00
£614.98/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CXCL14/BRAK, Human

CXCL14/BRAK, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.