Skip to product information
1 of 1

CXCL15, Mouse (HEK293, His)

CXCL15, Mouse (HEK293, His)

Size

SKU:QM-0176812-01

£310.01 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CXCL15, also known as Lungkine or WECHE, is a member of the ELR motif-containing CXC chemokines. CXCL15 has neutrophil chemotactic activity. CXCL15 is high expression in the lungs of mice[1][2]. CXCL15 Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 142 amino acids (Q26-A167) .

  • Molecular Formula

    20309 (Gene_ID) Q9WVL7 (Q26-A167) (Accession)

  • Smiles

    QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

  • Purity

    95.9

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0176812-01
10 µgQM-0176812-01
£310.01/ea
£0.00
£310.01/ea £0.00
50 µgQM-0176812-02
50 µgQM-0176812-02
£777.78/ea
£0.00
£777.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CXCL15, Mouse (HEK293, His)

CXCL15, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.