CXCL17, Rat

Name: CXCL17, Rat
Brand: QuantiMol
SKU: QM-0203453-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203453-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
C-X-C motif chemokine ligand 17 is the chemokine family member, and has a causative and protective effect in tumorigenesis. CXCL17 Protein, Rat is the recombinant rat-derived CXCL17 protein, expressed by E. coli , with tag free.
Molecular Formula
308436 (Gene_ID) D4A875 (S23-L119) (Accession)
Smiles
SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203453-01	2 µgQM-0203453-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203453-02	10 µgQM-0203453-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0203453-03	50 µgQM-0203453-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0203453-04	100 µgQM-0203453-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CXCL17, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.