CXCL3/CINC-2 alpha, Rat (CHO)

Name: CXCL3/CINC-2 alpha, Rat (CHO)
Brand: QuantiMol
SKU: QM-0186692-01
Price: 117.25 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0186692-01

£117.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. CXCL3 Protein, Rat (CHO) is produced in CHO cells.
Molecular Formula
171551 (Gene_ID) Q10746-1 (R33-S100) (Accession)
Smiles
RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0186692-01	10 µgQM-0186692-01 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0186692-02	50 µgQM-0186692-02 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

CXCL3/CINC-2 alpha, Rat (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.