CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Molecular Formula
3579 (Gene_ID) P25025 (M1-E40) (Accession)
Smiles
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
