Skip to product information
1 of 1

CYB5R1, Human (His)

CYB5R1, Human (His)

Size

SKU:QM-0200002-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CYB5R1 is an important member of the NADH-cytochrome b5 reductase family and plays a crucial role in fatty acid desaturation, cholesterol biosynthesis, drug metabolism, and erythrocyte methemoglobin reduction. Utilizing NADH, CYB5R1 promotes the reduction of cytochrome b5, contributing to enzymatic processes in lipid metabolism, sterol synthesis, and drug biotransformation. CYB5R1 Protein, Human (His) is the recombinant human-derived CYB5R1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    51706 (Gene_ID) Q9UHQ9 (L29-Y305) (Accession)

  • Smiles

    LVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200002-01
5 µgQM-0200002-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0200002-02
10 µgQM-0200002-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0200002-03
50 µgQM-0200002-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

CYB5R1, Human (His)

CYB5R1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.