Name: Cyclophilin A, Mouse
Brand: QuantiMol
SKU: QM-0205465-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
Cyclophilin A protein catalyzes the isomerization of proline imide peptide bonds in oligopeptides. Cyclophilin A Protein, Mouse is the recombinant mouse-derived Cyclophilin A protein, expressed by E. coli , with tag free.
Molecular Formula
268373 (Gene_ID) P17742 (M1-L164) (Accession)
Smiles
MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205465-01	2 µgQM-0205465-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205465-02	10 µgQM-0205465-02 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

50 µgQM-0205465-03	50 µgQM-0205465-03 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

100 µgQM-0205465-04	100 µgQM-0205465-04 £256.55/ea	£0.00	Quantity	£256.55/ea	£0.00

500 µgQM-0205465-05	500 µgQM-0205465-05 £629.55/ea	£0.00	Quantity	£629.55/ea	£0.00

1 mgQM-0205465-06	1 mgQM-0205465-06 £1,035.37/ea	£0.00	Quantity	£1,035.37/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Cyclophilin A, Mouse

Cyclophilin A, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.