Skip to product information
1 of 1

Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His)

Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His)

Size

SKU:QM-0184026-01

£299.07 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-23 alpha and IL-12 beta are the IL-23p19 and IL-12p40 subunits, respectively, composing IL-23 via heterodimerization manner. IL-23 binds to a heterodimeric receptor composed of IL-12RB1 and IL-23R, activates the Jak-Stat signaling cascade, acts on memory CD4 (+) T cells preferentially[1]. IL-23 also involves in activation of several pathways including p38 MAPK or NF-κB and promotes the production of pro-inflammatory cytokines such as interleukin-17A/IL17A[2]. Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein is produced in HEK293 cells, with total length of 481 amino acids and a N-Terminal His-tag.

  • Molecular Formula

    102128555&16160 (Gene_ID) A0A2K5TLV4 (V22-P189) &P43432 (M23-S335) (Accession)

  • Smiles

    VPGGSSPAWAQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIRQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0184026-01
20 µgQM-0184026-01
£299.07/ea
£0.00
£299.07/ea £0.00
50 µgQM-0184026-02
50 µgQM-0184026-02
£509.27/ea
£0.00
£509.27/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His)

Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.